PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024279
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 164aa    MW: 18265.5 Da    PI: 5.2233
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024279genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.18e-133588558
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58
                 ++ +r+q+NRe+ArrsR RK++ ++ L   v +L +eN++    ++  +++  +
  Lus10024279 35 RKRKRMQSNRESARRSRMRKQKHLDDLVVQVSQLRKENSQILAAVNVTTQHFLN 88
                 6789**********************************9988777766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-183195IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4043396IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-103380No hitNo description
SuperFamilySSF579596.13E-123587No hitNo description
PfamPF001704.8E-103578IPR004827Basic-leucine zipper domain
CDDcd147023.16E-213686No hitNo description
PROSITE patternPS0003603853IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSGNSSS PGGSSSVLLN SGSDEDLQQL VMDERKRKRM QSNRESARRS RMRKQKHLDD  60
LVVQVSQLRK ENSQILAAVN VTTQHFLNVE ADNSVLRAQI VELTHRLDSL TEILDFMGNG  120
PCSWETDQVV VDCIQPAESF LNNPLNSIYL NQPIMASPDL FQY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13455RKRKRMQSNRESARRSRMRKQK
24754RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011048821.12e-65PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A067KQY22e-64A0A067KQY2_JATCU; Uncharacterized protein
TrEMBLB9H4F32e-64B9H4F3_POPTR; BZIP transcription factor family protein
STRINGPOPTR_0005s25290.16e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61334147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-48basic leucine-zipper 44